Hub Route Reference
Active public Hub launch routes on the Om API `/v2/hub/*` surface.
All active Hub launch routes are asynchronous POST endpoints. They
return an accepted response with job_id and status, require
x-api-key, and support Idempotency-Key so you can retry safely.
Routes that start from uploaded structures use artifact_id values from
/v2/artifacts/upload.
Active Public Model Routes
| Model | Route | Primary Inputs | Input Style |
|---|---|---|---|
| Boltz2 | /v2/hub/boltz2/start | protein_sequence plus optional ligand or nucleic-acid context | Sequence |
| BoltzGen | /v2/hub/boltzgen/start | protocol plus protocol-specific target CIF artifact or ligand SMILES | Mixed |
| RosettaFold3 | /v2/hub/rosettafold3/start | protein_sequence | Sequence |
| Chai1 | /v2/hub/chai1/start | protein_sequence plus optional ligand or nucleic-acid context | Sequence |
| RFD3 | /v2/hub/rfd3/start | pdb_artifact_id, design_mode, contig | Artifact |
| BindCraft | /v2/hub/bindcraft/start | target_pdb_artifact_id plus optional target context fields | Artifact |
| AlphaFold | /v2/hub/alphafold/start | protein_sequence plus optional multimer selector | Sequence |
| ProteinTTT | /v2/hub/proteinttt/start | sequence | Sequence |
| DiffDock | /v2/hub/diffdock/start | protein_artifact_id, ligand_smiles | Artifact |
| FlowDock | /v2/hub/flowdock/start | protein_artifact_id, ligand_smiles | Artifact |
| NeuralPLexer | /v2/hub/neuralplexer/start | protein_sequence, ligand_smiles, optional protein_sequences_additional | Sequence |
| OpenFold3 | /v2/hub/openfold3/start | protein_sequence plus optional ligand or nucleic-acid context | Sequence |
| LULA1 | /v2/hub/lula1/start | protein_sequence plus vendor, sample size, and output controls | Molecule scoring |
/v2/hub/boltz2/startBoltz2
Launch the active Boltz2 workflow with a primary protein sequence and optional ligand or nucleic-acid context.
curl -X POST https://api.omtx.ai/v2/hub/boltz2/start \
-H "x-api-key: YOUR_API_KEY" \
-H "Idempotency-Key: boltz2-demo-001" \
-H "Content-Type: application/json" \
-d '{
"protein_sequence": "MSTNPKPQRKTKRNTNRRPQDVKFPGG",
"ligand_smiles": "CCO"
}'{
"job_id": "job_boltz2_123",
"status": "queued"
}/v2/hub/boltzgen/startBoltzGen
Launch the active BoltzGen workflow with the required `protocol` field and optional uploaded target structure context.
curl -X POST https://api.omtx.ai/v2/hub/boltzgen/start \
-H "x-api-key: YOUR_API_KEY" \
-H "Idempotency-Key: boltzgen-demo-001" \
-H "Content-Type: application/json" \
-d '{
"protocol": "protein_anything",
"target_cif_artifact_id": "11111111-1111-1111-1111-111111111111",
"target_chain_id": "A",
"binder_length_min": 60,
"binder_length_max": 90
}'{
"job_id": "job_boltzgen_123",
"status": "queued"
}/v2/hub/rosettafold3/startRosettaFold3
Launch RosettaFold3 with a single protein sequence.
curl -X POST https://api.omtx.ai/v2/hub/rosettafold3/start \
-H "x-api-key: YOUR_API_KEY" \
-H "Idempotency-Key: rf3-demo-001" \
-H "Content-Type: application/json" \
-d '{
"protein_sequence": "MSTNPKPQRKTKRNTNRRPQDVKFPGG"
}'{
"job_id": "job_rosettafold3_123",
"status": "queued"
}/v2/hub/chai1/startChai1
Launch Chai1 with a primary protein sequence and optional ligand or nucleic-acid context.
curl -X POST https://api.omtx.ai/v2/hub/chai1/start \
-H "x-api-key: YOUR_API_KEY" \
-H "Idempotency-Key: chai1-demo-001" \
-H "Content-Type: application/json" \
-d '{
"protein_sequence": "MSTNPKPQRKTKRNTNRRPQDVKFPGG",
"ligand_smiles": "CCO"
}'{
"job_id": "job_chai1_123",
"status": "queued"
}/v2/hub/rfd3/startRFD3
Launch RFD3 from an uploaded structure, a design mode, and a contig string.
curl -X POST https://api.omtx.ai/v2/hub/rfd3/start \
-H "x-api-key: YOUR_API_KEY" \
-H "Idempotency-Key: rfd3-demo-001" \
-H "Content-Type: application/json" \
-d '{
"pdb_artifact_id": "11111111-1111-1111-1111-111111111111",
"design_mode": "ppi_binder",
"contig": "A1-120/0 60-80",
"hotspot_selection": "E64:CD2,CZ;E88:CG,CZ"
}'{
"job_id": "job_rfd3_123",
"status": "queued"
}ppi_binderrequireshotspot_selection.small_molecule_binderrequiresligandinstead.
/v2/hub/bindcraft/startBindCraft
Launch BindCraft against an uploaded target structure artifact.
curl -X POST https://api.omtx.ai/v2/hub/bindcraft/start \
-H "x-api-key: YOUR_API_KEY" \
-H "Idempotency-Key: bindcraft-demo-001" \
-H "Content-Type: application/json" \
-d '{
"target_pdb_artifact_id": "11111111-1111-1111-1111-111111111111",
"target_chains": "A",
"target_name": "p53_target",
"hotspot_residues": "A94,A95,A96"
}'{
"job_id": "job_bindcraft_123",
"status": "queued"
}- BindCraft runs with a fixed profile. Do not send settings such as
design_protocolormpnn_model.
/v2/hub/alphafold/startAlphaFold
Launch AlphaFold with a primary protein sequence and optional multimer selector.
curl -X POST https://api.omtx.ai/v2/hub/alphafold/start \
-H "x-api-key: YOUR_API_KEY" \
-H "Idempotency-Key: alphafold-demo-001" \
-H "Content-Type: application/json" \
-d '{
"protein_sequence": "MSTNPKPQRKTKRNTNRRPQDVKFPGG",
"model_type": "auto"
}'{
"job_id": "job_alphafold_123",
"status": "queued"
}/v2/hub/proteinttt/startProteinTTT
Launch ProteinTTT with a single sequence.
curl -X POST https://api.omtx.ai/v2/hub/proteinttt/start \
-H "x-api-key: YOUR_API_KEY" \
-H "Idempotency-Key: proteinttt-demo-001" \
-H "Content-Type: application/json" \
-d '{
"sequence": "MSTNPKPQRKTKRNTNRRPQDVKFPGG"
}'{
"job_id": "job_proteinttt_123",
"status": "queued"
}/v2/hub/diffdock/startDiffDock
Launch DiffDock docking from an uploaded protein artifact and ligand SMILES string.
curl -X POST https://api.omtx.ai/v2/hub/diffdock/start \
-H "x-api-key: YOUR_API_KEY" \
-H "Idempotency-Key: diffdock-demo-001" \
-H "Content-Type: application/json" \
-d '{
"protein_artifact_id": "11111111-1111-1111-1111-111111111111",
"ligand_smiles": "CCO"
}'{
"job_id": "job_diffdock_123",
"status": "queued"
}/v2/hub/flowdock/startFlowDock
Launch FlowDock docking from an uploaded protein artifact and ligand SMILES string.
curl -X POST https://api.omtx.ai/v2/hub/flowdock/start \
-H "x-api-key: YOUR_API_KEY" \
-H "Idempotency-Key: flowdock-demo-001" \
-H "Content-Type: application/json" \
-d '{
"protein_artifact_id": "11111111-1111-1111-1111-111111111111",
"ligand_smiles": "CCO"
}'{
"job_id": "job_flowdock_123",
"status": "queued"
}/v2/hub/neuralplexer/startNeuralPLexer
Launch NeuralPLexer with a primary protein sequence and ligand SMILES string.
curl -X POST https://api.omtx.ai/v2/hub/neuralplexer/start \
-H "x-api-key: YOUR_API_KEY" \
-H "Idempotency-Key: neuralplexer-demo-001" \
-H "Content-Type: application/json" \
-d '{
"protein_sequence": "MSTNPKPQRKTKRNTNRRPQDVKFPGG",
"ligand_smiles": "CCO"
}'{
"job_id": "job_neuralplexer_123",
"status": "queued"
}/v2/hub/openfold3/startOpenFold3
Launch OpenFold3 with a primary protein sequence and optional ligand or nucleic-acid context.
curl -X POST https://api.omtx.ai/v2/hub/openfold3/start \
-H "x-api-key: YOUR_API_KEY" \
-H "Idempotency-Key: openfold3-demo-001" \
-H "Content-Type: application/json" \
-d '{
"protein_sequence": "MSTNPKPQRKTKRNTNRRPQDVKFPGG",
"ligand_smiles": "CCO"
}'{
"job_id": "job_openfold3_123",
"status": "queued"
}/v2/hub/lula1/startLULA1
Launch LULA1 to score accessible molecule space for a target protein.
curl -X POST https://api.omtx.ai/v2/hub/lula1/start \
-H "x-api-key: YOUR_API_KEY" \
-H "Idempotency-Key: lula1-demo-001" \
-H "Content-Type: application/json" \
-d '{
"protein_uuid": "YOUR_PROTEIN_UUID",
"protein_sequence": "MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLP",
"mode": "score_accessible_space",
"vendor": "one-pot",
"n": 1000,
"top_k": 100,
"seed": 42
}'{
"job_id": "job_lula1_123",
"status": "queued"
}- LULA1 scoring uses model access; it does not grant raw Generated Data access.